PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_19838_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 413aa    MW: 45527.6 Da    PI: 5.1107
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_19838_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.73.2e-21114169156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe+lF+++++p++++r eL+++l L++rqVk+WFqNrR+++k
  Neem_19838_f_1 114 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLCLETRQVKFWFQNRRTQMK 169
                     688999***********************************************999 PP

2START36.11.6e-12323400169
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCG CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddk 69 
                     ela++a++elvk+a+ +ep+W +s     e +n++e++++f++  +     + +ea+r+sg+v+ ++  lve+l+d +
  Neem_19838_f_1 323 ELALAAMDELVKMAQTDEPLWIRSLeggrEVLNREEYMRTFTPCIGmkptgFVTEASRESGMVIINSLALVETLMDPM 400
                     5899**************************************99989****************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.28E-2197171IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-22100171IPR009057Homeodomain-like
PROSITE profilePS5007117.216111171IPR001356Homeobox domain
SMARTSM003891.7E-17112175IPR001356Homeobox domain
CDDcd000866.95E-19113171No hitNo description
PfamPF000468.7E-19114169IPR001356Homeobox domain
PROSITE patternPS000270146169IPR017970Homeobox, conserved site
PROSITE profilePS5084812.817314398IPR002913START domain
PfamPF018524.3E-8323400IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MSFGGFLDNS SGGGGARIVA DISYSNNMPT TTLAQPRLVT PSLTKSMFNS PGLSLALQQP  60
NIDNQGDMPR MGENFESVAG RRSREEEHES RSGSENMDGA SGDDQDAADN PPRKKRYHRH  120
TPQQIQELEA LFKECPHPDE KQRLELSRRL CLETRQVKFW FQNRRTQMKT QLERHENSLL  180
RQENDKLRAE NMSIRDAMRN PICTNCGGPA IIGDISLEEQ HLRIENARLK DELDRVCALA  240
GKFLGRPISS LATSMAPPMP NSSLELGVGS NGFGGLSPVT TTLPLGPDFG GGISNPLPVM  300
PPNRSTAGVT GLDRSIERSM FLELALAAMD ELVKMAQTDE PLWIRSLEGG REVLNREEYM  360
RTFTPCIGMK PTGFVTEASR ESGMVIINSL ALVETLMDPM GLVLCSFVCL DDS
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4593075e-40AM459307.2 Vitis vinifera contig VV78X101111.6, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051914.10.0HD domain class transcription factor isoform 3, partial
RefseqXP_007051912.10.0HD domain class transcription factor isoform 1
SwissprotQ0WV121e-165ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A061DVH80.0A0A061DVH8_THECC; HD domain class transcription factor isoform 3 (Fragment)
TrEMBLA0A061DTE30.0A0A061DTE3_THECC; HD domain class transcription factor isoform 1
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
STRINGPOPTR_0014s07130.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.21e-141HD-ZIP family protein